SCOPe 2.05: Domain d2j1tb_: 2j1t B:

Lineage for d2j1tb_ (2j1t B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (31 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [193202] (6 PDB entries)

8. Domain d2j1tb_: 2j1t B: [193859]
   automated match to d3le0a_
   complexed with ca, fuc

Details for d2j1tb_

PDB Entry: 2j1t, 1.6 Å

PDB Description: structure of a streptococcus pneumoniae fucose binding module in complex with the lewis y antigen

PDB Compounds: (B:) fucolectin-related protein

SCOPe Domain Sequences for d2j1tb_:

Sequence; same for both SEQRES and ATOM records:

>d2j1tb_ b.18.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
tsgvplslaevevfres

Timeline for d2j1tb_:

• d2j1tb_ first appeared in SCOPe 2.02
  
• d2j1tb_ appears in SCOPe 2.04
  
• d2j1tb_ appears in SCOPe 2.06
  
• d2j1tb_ appears in the current release, SCOPe 2.08