Lineage for d1w2la_ (1w2l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981522Species Rhodothermus marinus [TaxId:29549] [193856] (1 PDB entry)
  8. 1981523Domain d1w2la_: 1w2l A: [193857]
    automated match to d1cora_
    complexed with act, hem, trs

Details for d1w2la_

PDB Entry: 1w2l (more details), 1.3 Å

PDB Description: cytochrome c domain of caa3 oxygen oxidoreductase
PDB Compounds: (A:) cytochrome oxidase subunit II

SCOPe Domain Sequences for d1w2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2la_ a.3.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mplaelgarlyrekacfschsidgsrlvgpsfkglygstrtfedgttavadenylresil
qpgakvvqgypnvmpasyaslserevaaliefikqqq

SCOPe Domain Coordinates for d1w2la_:

Click to download the PDB-style file with coordinates for d1w2la_.
(The format of our PDB-style files is described here.)

Timeline for d1w2la_: