| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (16 species) not a true protein |
| Species Rhodothermus marinus [TaxId:29549] [193856] (1 PDB entry) |
| Domain d1w2la_: 1w2l A: [193857] automated match to d1cora_ complexed with act, hem, trs |
PDB Entry: 1w2l (more details), 1.3 Å
SCOPe Domain Sequences for d1w2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2la_ a.3.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mplaelgarlyrekacfschsidgsrlvgpsfkglygstrtfedgttavadenylresil
qpgakvvqgypnvmpasyaslserevaaliefikqqq
Timeline for d1w2la_: