SCOPe 2.05: Domain d1z6ga_: 1z6g A:

Lineage for d1z6ga_ (1z6g A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)

8. Domain d1z6ga_: 1z6g A: [193846]
   automated match to d2qora_
   complexed with epe, so4

Details for d1z6ga_

PDB Entry: 1z6g, 2.18 Å

PDB Description: Crystal structure of guanylate kinase from Plasmodium falciparum

PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d1z6ga_:

Sequence; same for both SEQRES and ATOM records:

>d1z6ga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
niyplvicgpsgvgkgtlikkllnefpnyfyfsvscttrkkrekekegvdyyfidktife
dklknedfleydnyannfygtlkseydkakeqnkiclfemningvkqlkksthiknalyi
fikppstdvllsrlltrntenqeqiqkrmeqlnielheanllnfnlsiinddltltyqql
knyllnsyihl

Timeline for d1z6ga_:

• d1z6ga_ first appeared in SCOPe 2.02
  
• d1z6ga_ appears in SCOPe 2.04
  
• d1z6ga_ appears in SCOPe 2.06
  
• d1z6ga_ appears in the current release, SCOPe 2.08