Lineage for d2fpqa1 (2fpq A:1-424)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530187Species Clostridium botulinum [TaxId:1491] [193827] (9 PDB entries)
  8. 2530188Domain d2fpqa1: 2fpq A:1-424 [193828]
    Other proteins in same PDB: d2fpqa2
    automated match to d3fiea_
    complexed with k, zn

Details for d2fpqa1

PDB Entry: 2fpq (more details), 1.65 Å

PDB Description: Crystal Structure of Botulinum Neurotoxin Type D Light Chain
PDB Compounds: (A:) botulinum neurotoxin d light chain

SCOPe Domain Sequences for d2fpqa1:

Sequence, based on SEQRES records: (download)

>d2fpqa1 d.92.1.0 (A:1-424) automated matches {Clostridium botulinum [TaxId: 1491]}
mtwpvkdfnysdpvndndilylripqnklittpvkafmitqniwviperfssdtnpslsk
pprptskyqsyydpsylstdeqkdtflkgiiklfkrinerdigkklinylvvgspfmgds
stpedtfdftrhttniavekfengswkvtniitpsvlifgplpnildytasltlqgqqsn
psfegfgtlsilkvapeflltfsdvtsnqssavlgksifcmdpvialmhelthslhqlyg
inipsdkrirpqvsegffsqdgpnvqfeelytfggldveiipqiersqlrekalghykdi
akrlnninktipsswisnidkykkifsekynfdkdntgnfvvnidkfnslysdltnvmse
vvyssqynvknrthyfsrhylpvfanilddniytirdgfnltnkgfniensgqniernpa
lqkl

Sequence, based on observed residues (ATOM records): (download)

>d2fpqa1 d.92.1.0 (A:1-424) automated matches {Clostridium botulinum [TaxId: 1491]}
mtwpvkdfnysdpvndndilylripqnklittpvkafmitqniwviperfssdtnpslsk
pprptskyqsyydpsylstdeqkdtflkgiiklfkrinerdigkklinylvvgspfmgds
stpedtfdftrhttniavekfengswkvtniitpsvlifgplpnildytasltlqsnpsf
egfgtlsilkvapeflltfsdvgksifcmdpvialmhelthslhqlyginipsdkrirpq
vsegffsqdgpnvqfeelytfggldveiipqiersqlrekalghykdiakrlnninktip
sswisnidkykkifsekynfdkdntgnfvvnidkfnslysdltnvmsevvyssqynvknr
thyfsrhylpvfanilddniytirdgfnltnkgfniensgqniernpalqkl

SCOPe Domain Coordinates for d2fpqa1:

Click to download the PDB-style file with coordinates for d2fpqa1.
(The format of our PDB-style files is described here.)

Timeline for d2fpqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpqa2