SCOPe 2.03: Domain d1e7ca3: 1e7c A:389-584

Lineage for d1e7ca3 (1e7c A:389-584)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries)
   Uniprot P02768 29-596

8. Domain d1e7ca3: 1e7c A:389-584 [19380]
   complexed with hlt, myr

Details for d1e7ca3

PDB Entry: 1e7c, 2.4 Å

PDB Description: human serum albumin complexed with myristic acid and the general anesthetic halothane

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1e7ca3:

Sequence; same for both SEQRES and ATOM records:

>d1e7ca3 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

Timeline for d1e7ca3:

• d1e7ca3 first appeared (with stable ids) in SCOP 1.55
  
• d1e7ca3 appears in SCOPe 2.02
  
• d1e7ca3 appears in SCOPe 2.04
  
• d1e7ca3 appears in the current release, SCOPe 2.08