Lineage for d2yi0a_ (2yi0 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217156Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1217157Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1217158Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1217308Protein automated matches [190229] (6 species)
    not a true protein
  7. 1217321Species Human (Homo sapiens) [TaxId:9606] [187292] (42 PDB entries)
  8. 1217336Domain d2yi0a_: 2yi0 A: [193789]
    automated match to d3r4pb_
    complexed with mg, yi0

Details for d2yi0a_

PDB Entry: 2yi0 (more details), 1.6 Å

PDB Description: Structural characterization of 5-Aryl-4-(5-substituted-2-4- dihydroxyphenyl)-1,2,3-thiadiazole Hsp90 inhibitors.
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d2yi0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yi0a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d2yi0a_:

Click to download the PDB-style file with coordinates for d2yi0a_.
(The format of our PDB-style files is described here.)

Timeline for d2yi0a_: