Lineage for d4f63a_ (4f63 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930369Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1930370Species Human (Homo sapiens) [TaxId:9606] [56159] (29 PDB entries)
  8. 1930415Domain d4f63a_: 4f63 A: [193783]
    automated match to d3ky2a_
    complexed with 0s7, edo

Details for d4f63a_

PDB Entry: 4f63 (more details), 2.55 Å

PDB Description: Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 1
PDB Compounds: (A:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d4f63a_:

Sequence, based on SEQRES records: (download)

>d4f63a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts

Sequence, based on observed residues (ATOM records): (download)

>d4f63a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgqvvlaeaiglpnrvtkvavkmlksdatekdlsdlisem
emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskdlvsca
yqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttngrlpv
kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
ctnelymmmrdcwhavpsqrptfkqlvedldrivalts

SCOPe Domain Coordinates for d4f63a_:

Click to download the PDB-style file with coordinates for d4f63a_.
(The format of our PDB-style files is described here.)

Timeline for d4f63a_: