SCOPe 2.04: Domain d4dz0a_: 4dz0 A:

Lineage for d4dz0a_ (4dz0 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (15 PDB entries)

8. Domain d4dz0a_: 4dz0 A: [193756]
   automated match to d2fhaa_
   complexed with aen, ca, cu

Details for d4dz0a_

PDB Entry: 4dz0, 2.5 Å

PDB Description: Crystal structure of the Cu-adduct of human H-Ferritin variant MIC1 labeled with a dansyl fluorophore

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d4dz0a_:

Sequence; same for both SEQRES and ATOM records:

>d4dz0a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmseyfdrddvalknfacyfhhqsheehe
hahklmklqeqrggriflqdiqkadeddwesglnameaalhleknvnqsllelhklatdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d4dz0a_:

• d4dz0a_ first appeared in SCOPe 2.02
  
• d4dz0a_ appears in SCOPe 2.03
  
• d4dz0a_ appears in SCOPe 2.05
  
• d4dz0a_ appears in the current release, SCOPe 2.08