SCOPe 2.04: Domain d3v62d_: 3v62 D:

Lineage for d3v62d_ (3v62 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (4 PDB entries)

8. Domain d3v62d_: 3v62 D: [193752]
   Other proteins in same PDB: d3v62b1, d3v62b2, d3v62e1, d3v62e2
   automated match to d1euvb_
   protein/DNA complex; complexed with neq, so4

Details for d3v62d_

PDB Entry: 3v62, 2.9 Å

PDB Description: structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164

PDB Compounds: (D:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d3v62d_:

Sequence; same for both SEQRES and ATOM records:

>d3v62d_ d.15.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreqigg

Timeline for d3v62d_:

• d3v62d_ first appeared in SCOPe 2.02
  
• d3v62d_ appears in SCOPe 2.03
  
• d3v62d_ appears in SCOPe 2.05
  
• d3v62d_ appears in the current release, SCOPe 2.08