SCOPe 2.02: Domain d3p9wc_: 3p9w C:

Lineage for d3p9wc_ (3p9w C:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (3 PDB entries)

8. Domain d3p9wc_: 3p9w C: [193750]
   Other proteins in same PDB: d3p9wb_
   automated match to d1katv_

Details for d3p9wc_

PDB Entry: 3p9w, 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF

PDB Compounds: (C:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d3p9wc_:

Sequence; same for both SEQRES and ATOM records:

>d3p9wc_ g.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d3p9wc_:

• d3p9wc_ is new in SCOPe 2.02-stable
  
• d3p9wc_ appears in SCOPe 2.03
  
• d3p9wc_ appears in the current release, SCOPe 2.08