Lineage for d3p9wb_ (3p9w B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105682Species Human (Homo sapiens) [TaxId:9606] [188740] (31 PDB entries)
  8. 1105736Domain d3p9wb_: 3p9w B: [193748]
    Other proteins in same PDB: d3p9wc_
    automated match to d3b9vd_

Details for d3p9wb_

PDB Entry: 3p9w (more details), 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF
PDB Compounds: (B:) human VEGF

SCOPe Domain Sequences for d3p9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9wb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeelvariyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycyyhyygwhpgyglsyssgqgtlvt
vss

SCOPe Domain Coordinates for d3p9wb_:

Click to download the PDB-style file with coordinates for d3p9wb_.
(The format of our PDB-style files is described here.)

Timeline for d3p9wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3p9wc_