Lineage for d3sdis_ (3sdi S:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2550117Domain d3sdis_: 3sdi S: [193747]
    Other proteins in same PDB: d3sdi1_, d3sdi2_, d3sdia_, d3sdib_, d3sdic_, d3sdid_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdip_, d3sdiq_, d3sdir_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_
    automated match to d1rypf_
    complexed with 3sd, mes, mg

Details for d3sdis_

PDB Entry: 3sdi (more details), 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20
PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3sdis_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdis_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkkii
kcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsag
grpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikidg
npdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d3sdis_:

Click to download the PDB-style file with coordinates for d3sdis_.
(The format of our PDB-style files is described here.)

Timeline for d3sdis_: