Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (34 species) not a true protein |
Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (1 PDB entry) |
Domain d2zyma_: 2zym A: [193733] automated match to d2ghaa_ complexed with acx |
PDB Entry: 2zym (more details), 1.8 Å
SCOPe Domain Sequences for d2zyma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zyma_ c.94.1.0 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} kpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpagkgad lvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesvaliyn kklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeqdgtl dpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwaikdyq aaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasrfket geippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaqgkqt peqalndavkimkekiqtmkq
Timeline for d2zyma_: