SCOPe 2.02: Domain d2zyma_: 2zym A:

Lineage for d2zyma_ (2zym A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (34 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (1 PDB entry)

8. Domain d2zyma_: 2zym A: [193733]
   automated match to d2ghaa_
   complexed with acx

Details for d2zyma_

PDB Entry: 2zym, 1.8 Å

PDB Description: crystal structure of cyclo/maltodextrin-binding protein complexed with alpha-cyclodextrin

PDB Compounds: (A:) Solute-binding protein

SCOPe Domain Sequences for d2zyma_:

Sequence; same for both SEQRES and ATOM records:

>d2zyma_ c.94.1.0 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
kpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpagkgad
lvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesvaliyn
kklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeqdgtl
dpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwaikdyq
aaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasrfket
geippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaqgkqt
peqalndavkimkekiqtmkq

Timeline for d2zyma_:

• d2zyma_ is new in SCOPe 2.02-stable
  
• d2zyma_ appears in SCOPe 2.03
  
• d2zyma_ appears in the current release, SCOPe 2.08