SCOPe 2.02: Domain d3mcwb_: 3mcw B:

Lineage for d3mcwb_ (3mcw B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (7 species)
   not a true protein

7. Species Chromobacterium violaceum [TaxId:243365] [193722] (1 PDB entry)

8. Domain d3mcwb_: 3mcw B: [193723]
   automated match to d3lqya_
   complexed with edo, iod

Details for d3mcwb_

PDB Entry: 3mcw, 1.06 Å

PDB Description: crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution

PDB Compounds: (B:) Putative hydrolase

SCOPe Domain Sequences for d3mcwb_:

Sequence; same for both SEQRES and ATOM records:

>d3mcwb_ c.33.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mpaplrfssdkpllllidmqqavddpswgprnhpqaeqacagllqawrarglplihirhd
svepnstyrpgqpghafkpeveprpgetviakqtnsafigtgleallrangwlelvvagv
stsnsveatvrmagnlgfavclaedgcftfdktdwhgrrrsadevhamslanldgeycrv
cgsadilaalgni

Timeline for d3mcwb_:

• d3mcwb_ is new in SCOPe 2.02-stable
  
• d3mcwb_ appears in SCOPe 2.03
  
• d3mcwb_ appears in the current release, SCOPe 2.08