Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (7 species) not a true protein |
Species Chromobacterium violaceum [TaxId:243365] [193722] (1 PDB entry) |
Domain d3mcwb_: 3mcw B: [193723] automated match to d3lqya_ complexed with edo, iod |
PDB Entry: 3mcw (more details), 1.06 Å
SCOPe Domain Sequences for d3mcwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcwb_ c.33.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]} mpaplrfssdkpllllidmqqavddpswgprnhpqaeqacagllqawrarglplihirhd svepnstyrpgqpghafkpeveprpgetviakqtnsafigtgleallrangwlelvvagv stsnsveatvrmagnlgfavclaedgcftfdktdwhgrrrsadevhamslanldgeycrv cgsadilaalgni
Timeline for d3mcwb_: