Lineage for d3qxic_ (3qxi C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853952Species Mycobacterium marinum [TaxId:216594] [189638] (4 PDB entries)
  8. 2853967Domain d3qxic_: 3qxi C: [193712]
    automated match to d3r9sa_

Details for d3qxic_

PDB Entry: 3qxi (more details), 2.2 Å

PDB Description: crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum
PDB Compounds: (C:) Enoyl-CoA hydratase EchA1

SCOPe Domain Sequences for d3qxic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxic_ c.14.1.0 (C:) automated matches {Mycobacterium marinum [TaxId: 216594]}
epevlveqrdriliitinrpkaknsvnaavsraladamdrldadaglsvgiltgaggsfc
agmdlkafargenvvvegrglgfterppakpliaavegyalaggtelalatdlivaards
afgipevkrglvaggggllrlperipyaiamelaltgdnlsaerahalgmvnvlaepgaa
ldaaialaekitangplavaatkriitesrgwsldtrfaqqmkilfpiftsndakegaia
faekrpprwtgt

SCOPe Domain Coordinates for d3qxic_:

Click to download the PDB-style file with coordinates for d3qxic_.
(The format of our PDB-style files is described here.)

Timeline for d3qxic_: