Lineage for d3nl0a_ (3nl0 A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1234135Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1234136Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1234607Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1234615Protein Viral RNA polymerase [56695] (16 species)
  7. 1234625Species Foot-and-mouth disease virus - type c [TaxId:12116] [187085] (9 PDB entries)
  8. 1234631Domain d3nl0a_: 3nl0 A: [193696]
    automated match to d1u09a_
    protein/RNA complex; complexed with mg; mutant

Details for d3nl0a_

PDB Entry: 3nl0 (more details), 2.6 Å

PDB Description: mutant p44s m296i of foot-and-mouth disease virus rna-dependent rna polymerase
PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d3nl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nl0a_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus - type c [TaxId: 12116]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdsrlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggipsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalah

SCOPe Domain Coordinates for d3nl0a_:

Click to download the PDB-style file with coordinates for d3nl0a_.
(The format of our PDB-style files is described here.)

Timeline for d3nl0a_: