SCOPe 2.05: Domain d3rt3c_: 3rt3 C:

Lineage for d3rt3c_ (3rt3 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (6 species)
   not a true protein

7. Species Influenza b virus [TaxId:107412] [193690] (3 PDB entries)

8. Domain d3rt3c_: 3rt3 C: [193691]
   Other proteins in same PDB: d3rt3b1, d3rt3b2
   automated match to d1xeqa1
   complexed with sin

Details for d3rt3c_

PDB Entry: 3rt3, 2.01 Å

PDB Description: complex of influenza virus protein with host anti-viral factor

PDB Compounds: (C:) Non-structural protein 1

SCOPe Domain Sequences for d3rt3c_:

Sequence; same for both SEQRES and ATOM records:

>d3rt3c_ a.16.1.1 (C:) automated matches {Influenza b virus [TaxId: 107412]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdpsagiegfep

Timeline for d3rt3c_:

• d3rt3c_ first appeared in SCOPe 2.02
  
• d3rt3c_ appears in SCOPe 2.04
  
• d3rt3c_ appears in SCOPe 2.06
  
• d3rt3c_ appears in the current release, SCOPe 2.08