Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries) |
Domain d3sh7b_: 3sh7 B: [193681] automated match to d3ly3a_ complexed with bb0 |
PDB Entry: 3sh7 (more details), 2.5 Å
SCOPe Domain Sequences for d3sh7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sh7b_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]} dfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnqr itytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelrk igdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkrn ttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakydd kliaeatkvvmkaln
Timeline for d3sh7b_: