SCOPe 2.04: Domain d3sh7b_: 3sh7 B:

Lineage for d3sh7b_ (3sh7 B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)

8. Domain d3sh7b_: 3sh7 B: [193681]
   automated match to d3ly3a_
   complexed with bb0

Details for d3sh7b_

PDB Entry: 3sh7, 2.5 Å

PDB Description: Crystal structure of fluorophore-labeled beta-lactamase PenP

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3sh7b_:

Sequence; same for both SEQRES and ATOM records:

>d3sh7b_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
dfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnqr
itytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelrk
igdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkrn
ttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakydd
kliaeatkvvmkaln

Timeline for d3sh7b_:

• d3sh7b_ first appeared in SCOPe 2.02
  
• d3sh7b_ appears in SCOPe 2.03
  
• d3sh7b_ appears in SCOPe 2.05
  
• d3sh7b_ appears in the current release, SCOPe 2.08