Class a: All alpha proteins [46456] (284 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (1 family) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries) Uniprot P02768 29-596 |
Domain d1e7ha3: 1e7h A:389-583 [19368] complexed with plm |
PDB Entry: 1e7h (more details), 2.43 Å
SCOPe Domain Sequences for d1e7ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7ha3 a.126.1.1 (A:389-583) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf aeegkklvaasqaal
Timeline for d1e7ha3: