Lineage for d3sxha_ (3sxh A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123682Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1123683Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1123859Protein automated matches [190761] (2 species)
    not a true protein
  7. 1123860Species Staphylococcus aureus [TaxId:1280] [188650] (45 PDB entries)
  8. 1123864Domain d3sxha_: 3sxh A: [193679]
    automated match to d3lx0a_
    complexed with ca, thp

Details for d3sxha_

PDB Entry: 3sxh (more details), 1.4 Å

PDB Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92AL103A at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3sxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxha_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayayadgkmvneaavrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3sxha_:

Click to download the PDB-style file with coordinates for d3sxha_.
(The format of our PDB-style files is described here.)

Timeline for d3sxha_: