Lineage for d3asoq_ (3aso Q:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1237972Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 1237973Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 1237990Protein automated matches [190270] (1 species)
    not a true protein
  7. 1237991Species Cow (Bos taurus) [TaxId:9913] [187062] (16 PDB entries)
  8. 1238012Domain d3asoq_: 3aso Q: [193676]
    Other proteins in same PDB: d3asoc_, d3asof_, d3asog_, d3ason_, d3asop_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asoq_

PDB Entry: 3aso (more details), 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d3asoq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asoq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d3asoq_:

Click to download the PDB-style file with coordinates for d3asoq_.
(The format of our PDB-style files is described here.)

Timeline for d3asoq_: