Lineage for d4dgna_ (4dgn A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221227Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1221265Species Maize (Zea mays) [TaxId:4577] [56143] (31 PDB entries)
  8. 1221270Domain d4dgna_: 4dgn A: [193611]
    automated match to d1ds5a_
    complexed with lu2

Details for d4dgna_

PDB Entry: 4dgn (more details), 1.75 Å

PDB Description: Crystal Structure of maize CK2 in complex with the inhibitor luteolin
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4dgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgna_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaen

SCOPe Domain Coordinates for d4dgna_:

Click to download the PDB-style file with coordinates for d4dgna_.
(The format of our PDB-style files is described here.)

Timeline for d4dgna_: