Lineage for d4e6kf_ (4e6k F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084902Protein automated matches [190041] (21 species)
    not a true protein
  7. 1085120Species Pseudomonas aeruginosa [TaxId:287] [189215] (2 PDB entries)
  8. 1085121Domain d4e6kf_: 4e6k F: [193610]
    automated match to d3is7s_
    complexed with fes, hem, k, na, po4

Details for d4e6kf_

PDB Entry: 4e6k (more details), 2 Å

PDB Description: 2.0 a resolution structure of pseudomonas aeruginosa bacterioferritin (bfrb) in complex with bacterioferritin associated ferredoxin (bfd)
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d4e6kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6kf_ a.25.1.1 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhed

SCOPe Domain Coordinates for d4e6kf_:

Click to download the PDB-style file with coordinates for d4e6kf_.
(The format of our PDB-style files is described here.)

Timeline for d4e6kf_: