SCOPe 2.08: Domain d3s4xa1: 3s4x A:1-361

Lineage for d3s4xa1 (3s4x A:1-361)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (10 PDB entries)
   Uniprot P05364 22-380 ! Uniprot P05364 22-381

8. Domain d3s4xa1: 3s4x A:1-361 [193609]
   Other proteins in same PDB: d3s4xa2
   automated match to d1gcea_
   complexed with so4; mutant

Details for d3s4xa1

PDB Entry: 3s4x, 1.95 Å

PDB Description: Crystal structure of the Asn152Gly mutant of P99 beta-lactamase

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3s4xa1:

Sequence; same for both SEQRES and ATOM records:

>d3s4xa1 e.3.1.1 (A:1-361) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
vpdevtdnasllrfyqnwqpqwkpgttrlyagasiglfgalavkpsgmpyeqamttrvlk
plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvve
vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
q

Timeline for d3s4xa1:

• d3s4xa1 first appeared in SCOPe 2.02, called d3s4xa_
  
• d3s4xa1 appears in SCOPe 2.07