Lineage for d3t63c_ (3t63 C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113967Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 1113968Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1113984Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1113992Species Pseudomonas putida [TaxId:303] [49487] (30 PDB entries)
  8. 1113993Domain d3t63c_: 3t63 C: [193606]
    Other proteins in same PDB: d3t63m_, d3t63n_, d3t63o_
    automated match to d3mv4a_
    complexed with bme, fe, gol, so4; mutant

Details for d3t63c_

PDB Entry: 3t63 (more details), 1.54 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
PDB Compounds: (C:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d3t63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t63c_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3t63c_:

Click to download the PDB-style file with coordinates for d3t63c_.
(The format of our PDB-style files is described here.)

Timeline for d3t63c_: