Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
Species Pseudomonas putida [TaxId:303] [49487] (30 PDB entries) |
Domain d3t63c_: 3t63 C: [193606] Other proteins in same PDB: d3t63m_, d3t63n_, d3t63o_ automated match to d3mv4a_ complexed with bme, fe, gol, so4; mutant |
PDB Entry: 3t63 (more details), 1.54 Å
SCOPe Domain Sequences for d3t63c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t63c_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk tayrfdiriqgegetvffdf
Timeline for d3t63c_: