SCOPe 2.06: Domain d3v5ma_: 3v5m A:

Lineage for d3v5ma_ (3v5m A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries)
   inhibited by tazobactam
   Uniprot Q5PSW7 ! Uniprot P14557 22-286

8. Domain d3v5ma_: 3v5m A: [193596]
   automated match to d1onga_
   complexed with ma4; mutant

Details for d3v5ma_

PDB Entry: 3v5m, 1.3 Å

PDB Description: Crystal structure of M69V mutant of SHV beta-lactamase

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3v5ma_:

Sequence; same for both SEQRES and ATOM records:

>d3v5ma_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmvstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d3v5ma_:

• d3v5ma_ first appeared in SCOPe 2.02
  
• d3v5ma_ appears in SCOPe 2.05
  
• d3v5ma_ appears in SCOPe 2.07
  
• d3v5ma_ appears in the current release, SCOPe 2.08