Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (18 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:316058] [193594] (1 PDB entry) |
Domain d4do1d_: 4do1 D: [193595] automated match to d1z8qa_ complexed with ann, cl, gol, hem, so4 |
PDB Entry: 4do1 (more details), 2 Å
SCOPe Domain Sequences for d4do1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4do1d_ a.104.1.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala rkvaaididgpvkrrfnntlrgleslpvkltpa
Timeline for d4do1d_: