SCOPe 2.03: Domain d3tefa_: 3tef A:

Lineage for d3tefa_ (3tef A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (18 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [193580] (1 PDB entry)

8. Domain d3tefa_: 3tef A: [193581]
   automated match to d2chub_

Details for d3tefa_

PDB Entry: 3tef, 1.7 Å

PDB Description: Crystal Structure of the Periplasmic Catecholate-Siderophore Binding Protein VctP from Vibrio Cholerae

PDB Compounds: (A:) Iron(III) ABC transporter, periplasmic iron-compound-binding protein

SCOPe Domain Sequences for d3tefa_:

Sequence; same for both SEQRES and ATOM records:

>d3tefa_ c.92.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
etvtiehrlgkttleqkpqrvvvigvgaldaidsfgiepvavskfdgtpdylakyksdky
psagslfepdfetiytqkpdlivigprasksydelskiaptivfaaeadqgywestqqqw
rnlgkvfaiepaveakieqvdaqfksimqynqqhksdamlvmssggnlttfgansrfssv
ykdfgfsetvpvskesshgdlisfeyirehnpktllvvdrdkvvtkgetnirqtfendlv
kattayknghiayldvnawyiaisgvkateqmvadmkas

Timeline for d3tefa_:

• d3tefa_ first appeared in SCOPe 2.02
  
• d3tefa_ appears in SCOPe 2.04
  
• d3tefa_ appears in the current release, SCOPe 2.08