SCOPe 2.02: Domain d4fm4j_: 4fm4 J:

Lineage for d4fm4j_ (4fm4 J:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (2 species)
   not a true protein

7. Species Comamonas testosteroni [TaxId:285] [193572] (1 PDB entry)

8. Domain d4fm4j_: 4fm4 J: [193573]
   Other proteins in same PDB: d4fm4o_
   automated match to d3a8gb_
   complexed with fe, po4

Details for d4fm4j_

PDB Entry: 4fm4, 2.38 Å

PDB Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1

PDB Compounds: (J:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d4fm4j_:

Sequence; same for both SEQRES and ATOM records:

>d4fm4j_ b.34.4.0 (J:) automated matches {Comamonas testosteroni [TaxId: 285]}
mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk
lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
kdlwpdgceaadvhvgvfqsyllsae

Timeline for d4fm4j_:

• d4fm4j_ is new in SCOPe 2.02-stable
  
• d4fm4j_ appears in SCOPe 2.03
  
• d4fm4j_ appears in the current release, SCOPe 2.08