Lineage for d1ao6a1 (1ao6 A:5-196)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6463Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 6464Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 6465Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 6466Protein Serum albumin [48554] (1 species)
  7. 6467Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries)
  8. 6474Domain d1ao6a1: 1ao6 A:5-196 [19354]

Details for d1ao6a1

PDB Entry: 1ao6 (more details), 2.5 Å

PDB Description: crystal structure of human serum albumin

SCOP Domain Sequences for d1ao6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao6a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens)}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOP Domain Coordinates for d1ao6a1:

Click to download the PDB-style file with coordinates for d1ao6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ao6a1: