SCOPe 2.02: Domain d3tnta_: 3tnt A:

Lineage for d3tnta_ (3tnt A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (57 PDB entries)

8. Domain d3tnta_: 3tnt A: [193531]
   automated match to d1z1ja_
   complexed with g85

Details for d3tnta_

PDB Entry: 3tnt, 1.59 Å

PDB Description: crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester inhibitor sg85

PDB Compounds: (A:) SARS coronavirus main protease

SCOPe Domain Sequences for d3tnta_:

Sequence; same for both SEQRES and ATOM records:

>d3tnta_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

Timeline for d3tnta_:

• d3tnta_ is new in SCOPe 2.02-stable
  
• d3tnta_ appears in SCOPe 2.03
  
• d3tnta_ appears in the current release, SCOPe 2.08