Lineage for d3qsub_ (3qsu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787114Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2787115Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2787209Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries)
  8. 2787229Domain d3qsub_: 3qsu B: [193522]
    automated match to d1kq1h_
    protein/RNA complex; complexed with zn

Details for d3qsub_

PDB Entry: 3qsu (more details), 2.2 Å

PDB Description: structure of staphylococcus aureus hfq in complex with a7 rna
PDB Compounds: (B:) RNA chaperone Hfq

SCOPe Domain Sequences for d3qsub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsub_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

SCOPe Domain Coordinates for d3qsub_:

Click to download the PDB-style file with coordinates for d3qsub_.
(The format of our PDB-style files is described here.)

Timeline for d3qsub_: