SCOPe 2.05: Domain d4gzea_: 4gze A:

Lineage for d4gzea_ (4gze A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:220668] [193494] (1 PDB entry)

8. Domain d4gzea_: 4gze A: [193495]
   automated match to d3qoma_
   complexed with cl, gol

Details for d4gzea_

PDB Entry: 4gze, 2.31 Å

PDB Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum (apo form)

PDB Compounds: (A:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d4gzea_:

Sequence; same for both SEQRES and ATOM records:

>d4gzea_ c.1.8.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 220668]}
amtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagk
yypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfd
eclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfn
einnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqig
cmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditae
dlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglrya
mnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdlig
ytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie

Timeline for d4gzea_:

• d4gzea_ first appeared in SCOPe 2.02
  
• d4gzea_ appears in SCOPe 2.04
  
• d4gzea_ is called d4gzea1 in SCOPe 2.06
  
• d4gzea_ appears in the current release, SCOPe 2.08, called d4gzea1