Lineage for d4gzea1 (4gze A:1-478)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832856Species Lactobacillus plantarum [TaxId:220668] [193494] (1 PDB entry)
  8. 2832857Domain d4gzea1: 4gze A:1-478 [193495]
    Other proteins in same PDB: d4gzea2, d4gzed2
    automated match to d3qoma_
    complexed with cl, gol

Details for d4gzea1

PDB Entry: 4gze (more details), 2.31 Å

PDB Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum (apo form)
PDB Compounds: (A:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d4gzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gzea1 c.1.8.0 (A:1-478) automated matches {Lactobacillus plantarum [TaxId: 220668]}
mtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagky
ypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfde
clkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfne
innqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigc
miamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaed
lkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglryam
nwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligy
tpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie

SCOPe Domain Coordinates for d4gzea1:

Click to download the PDB-style file with coordinates for d4gzea1.
(The format of our PDB-style files is described here.)

Timeline for d4gzea1: