Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Lactobacillus plantarum [TaxId:220668] [193494] (1 PDB entry) |
Domain d4gzea1: 4gze A:1-478 [193495] Other proteins in same PDB: d4gzea2, d4gzed2 automated match to d3qoma_ complexed with cl, gol |
PDB Entry: 4gze (more details), 2.31 Å
SCOPe Domain Sequences for d4gzea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gzea1 c.1.8.0 (A:1-478) automated matches {Lactobacillus plantarum [TaxId: 220668]} mtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagky ypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfde clkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfne innqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigc miamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaed lkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglryam nwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligy tpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
Timeline for d4gzea1: