Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) |
Protein Microphage migration inhibition factor (MIF) [55340] (6 species) synonym: glycosylation-inhibiting factor (GIF) |
Species Human (Homo sapiens) [TaxId:9606] [55341] (31 PDB entries) |
Domain d3smbc_: 3smb C: [193476] automated match to d3jsgc_ complexed with cl, le2, na |
PDB Entry: 3smb (more details), 1.6 Å
SCOPe Domain Sequences for d3smbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3smbc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d3smbc_: