Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (7 species) not a true protein |
Species Influenza a virus [TaxId:119210] [193455] (7 PDB entries) |
Domain d4gzxa_: 4gzx A: [193457] automated match to d1ivga_ complexed with ca, nag, sia; mutant |
PDB Entry: 4gzx (more details), 2.45 Å
SCOPe Domain Sequences for d4gzxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gzxa_ b.68.1.1 (A:) automated matches {Influenza a virus [TaxId: 119210]} aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn sivvfcgtsgtygtgswpdgadlnlmpi
Timeline for d4gzxa_: