Lineage for d4b95i_ (4b95 I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041766Protein automated matches [193392] (1 species)
    not a true protein
  7. 2041767Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2041776Domain d4b95i_: 4b95 I: [193439]
    Other proteins in same PDB: d4b95a_, d4b95b1, d4b95b2, d4b95c_, d4b95d_, d4b95e1, d4b95e2, d4b95f_, d4b95g_, d4b95h1, d4b95h2, d4b95j_, d4b95k1, d4b95k2, d4b95l_
    automated match to d1lm8v_
    complexed with act, uck

Details for d4b95i_

PDB Entry: 4b95 (more details), 2.8 Å

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4b95i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b95i_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

SCOPe Domain Coordinates for d4b95i_:

Click to download the PDB-style file with coordinates for d4b95i_.
(The format of our PDB-style files is described here.)

Timeline for d4b95i_: