SCOPe 2.02: Domain d4etmb_: 4etm B:

Lineage for d4etmb_ (4etm B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [193436] (1 PDB entry)

8. Domain d4etmb_: 4etm B: [193437]
   automated match to d5pnta_
   complexed with k, na, po4

Details for d4etmb_

PDB Entry: 4etm, 1.6 Å

PDB Description: Crystal structure of YfkJ from Bacillus subtilis

PDB Compounds: (B:) Low molecular weight protein-tyrosine-phosphatase yfkJ

SCOPe Domain Sequences for d4etmb_:

Sequence; same for both SEQRES and ATOM records:

>d4etmb_ c.44.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
grgsmisvlfvclgnicrspmaeaifrdlaakkglegkikadsagiggwhignpphegtq
eilrregisfdgmlarqvseqdlddfdyiiamdaenigslrsmagfkntshikrlldyve
dsdladvpdpyytgnfeevcqliktgceqllasiqkekq

Timeline for d4etmb_:

• d4etmb_ is new in SCOPe 2.02-stable
  
• d4etmb_ appears in SCOPe 2.03
  
• d4etmb_ appears in the current release, SCOPe 2.08, called d4etmb1