Lineage for d4awjd_ (4awj D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177277Domain d4awjd_: 4awj D: [193395]
    Other proteins in same PDB: d4awjb_, d4awjc_, d4awje_, d4awjf_, d4awjh_, d4awji_, d4awjk1, d4awjk2, d4awjl_
    automated match to d1lqba_
    complexed with act, acy, gol, v6f

Details for d4awjd_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (D:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4awjd_:

Sequence, based on SEQRES records: (download)

>d4awjd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpd

Sequence, based on observed residues (ATOM records): (download)

>d4awjd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafrdtfealciepfssppelpd

SCOPe Domain Coordinates for d4awjd_:

Click to download the PDB-style file with coordinates for d4awjd_.
(The format of our PDB-style files is described here.)

Timeline for d4awjd_: