SCOPe 2.03: Domain d4f0kb_: 4f0k B:

Lineage for d4f0kb_ (4f0k B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (5 species)
   not a true protein

7. Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193382] (3 PDB entries)

8. Domain d4f0kb_: 4f0k B: [193383]
   Other proteins in same PDB: d4f0ka1, d4f0ka2
   automated match to d1iwab_
   complexed with cl, co2, gol, mg

Details for d4f0kb_

PDB Entry: 4f0k, 2.05 Å

PDB Description: unactivated rubisco with magnesium and carbon dioxide bound

PDB Compounds: (B:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d4f0kb_:

Sequence; same for both SEQRES and ATOM records:

>d4f0kb_ d.73.1.1 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd
papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs
ikysiqayetykpedqry

Timeline for d4f0kb_:

• d4f0kb_ first appeared in SCOPe 2.02
  
• d4f0kb_ appears in SCOPe 2.04
  
• d4f0kb_ appears in the current release, SCOPe 2.08