SCOPe 2.02: Domain d3vbaf_: 3vba F:

Lineage for d3vbaf_ (3vba F:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.0: automated matches [191540] (1 protein)
   not a true family

6. Protein automated matches [190925] (1 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries)

8. Domain d3vbaf_: 3vba F: [193376]
   automated match to d2pkpa_

Details for d3vbaf_

PDB Entry: 3vba, 2 Å

PDB Description: Crystal structure of methanogen 3-isopropylmalate isomerase small subunit

PDB Compounds: (F:) Isopropylmalate/citramalate isomerase small subunit

SCOPe Domain Sequences for d3vbaf_:

Sequence; same for both SEQRES and ATOM records:

>d3vbaf_ c.8.2.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkma

Timeline for d3vbaf_:

• d3vbaf_ is new in SCOPe 2.02-stable
  
• d3vbaf_ appears in SCOPe 2.03
  
• d3vbaf_ appears in the current release, SCOPe 2.08