Lineage for d4b8wa1 (4b8w A:-1-320)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107911Domain d4b8wa1: 4b8w A:-1-320 [193375]
    Other proteins in same PDB: d4b8wa2, d4b8wb2
    automated match to d1bsva_
    complexed with gdp, nap

Details for d4b8wa1

PDB Entry: 4b8w (more details), 2.75 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, tetragonal crystal form
PDB Compounds: (A:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4b8wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8wa1 c.2.1.0 (A:-1-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthv
ihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypi
detmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedgh
vlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvge
edevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavk
etcawftdnyeqar

SCOPe Domain Coordinates for d4b8wa1:

Click to download the PDB-style file with coordinates for d4b8wa1.
(The format of our PDB-style files is described here.)

Timeline for d4b8wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b8wa2