SCOPe 2.03: Domain d4hk2c_: 4hk2 C:

Lineage for d4hk2c_ (4hk2 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)

8. Domain d4hk2c_: 4hk2 C: [193362]
   automated match to d3nobh_
   complexed with so4

Details for d4hk2c_

PDB Entry: 4hk2, 1.4 Å

PDB Description: U7Ub25.2540

PDB Compounds: (C:) Ubiquitin

SCOPe Domain Sequences for d4hk2c_:

Sequence; same for both SEQRES and ATOM records:

>d4hk2c_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmqifvkfrtgktytlevepsdtienvkakiqdklgippdqqwlifagkrledgrtlsd
yniqkestlrgvrrl

Timeline for d4hk2c_:

• d4hk2c_ first appeared in SCOPe 2.02
  
• d4hk2c_ appears in SCOPe 2.04
  
• d4hk2c_ appears in the current release, SCOPe 2.08, called d4hk2c1