Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (2 PDB entries) |
Domain d3w1sc_: 3w1s C: [193301] automated match to d1wz3a1 |
PDB Entry: 3w1s (more details), 2.6 Å
SCOPe Domain Sequences for d3w1sc_:
Sequence, based on SEQRES records: (download)
>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} iqkiqikfqpigsigqlkpsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqq nigelwmqfktndelivsycasvafg
>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} iqkiqikfqpigsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqqnigelwm qfktndelivsycafg
Timeline for d3w1sc_: