Lineage for d3w1sc_ (3w1s C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1403010Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1403011Protein automated matches [190233] (6 species)
    not a true protein
  7. 1403016Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (2 PDB entries)
  8. 1403018Domain d3w1sc_: 3w1s C: [193301]
    automated match to d1wz3a1

Details for d3w1sc_

PDB Entry: 3w1s (more details), 2.6 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae Atg12-Atg5 conjugate bound to the N-terminal domain of Atg16
PDB Compounds: (C:) Ubiquitin-like protein ATG12

SCOPe Domain Sequences for d3w1sc_:

Sequence, based on SEQRES records: (download)

>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
iqkiqikfqpigsigqlkpsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqq
nigelwmqfktndelivsycasvafg

Sequence, based on observed residues (ATOM records): (download)

>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
iqkiqikfqpigsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqqnigelwm
qfktndelivsycafg

SCOPe Domain Coordinates for d3w1sc_:

Click to download the PDB-style file with coordinates for d3w1sc_.
(The format of our PDB-style files is described here.)

Timeline for d3w1sc_: