Lineage for d4fyoa_ (4fyo A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931488Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931489Species Human (Homo sapiens) [TaxId:9606] [118132] (52 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1931490Domain d4fyoa_: 4fyo A: [193271]
    automated match to d1xbba_
    complexed with 0vf

Details for d4fyoa_

PDB Entry: 4fyo (more details), 1.4 Å

PDB Description: crystal structure of spleen tyrosine kinase complexed with n-{(s)-1- [7-(3,4-dimethoxy-phenylamino)-thiazolo[5,4-d]pyrimidin-5-yl]- pyrrolidin-3-yl}-terephthalamic acid
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4fyoa_:

Sequence, based on SEQRES records: (download)

>d4fyoa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvneghh

Sequence, based on observed residues (ATOM records): (download)

>d4fyoa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqld
npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
nfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfssk
sdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtyd
venrpgfaavelrlrnyyydvvneghh

SCOPe Domain Coordinates for d4fyoa_:

Click to download the PDB-style file with coordinates for d4fyoa_.
(The format of our PDB-style files is described here.)

Timeline for d4fyoa_: