SCOPe 2.05: Domain d4glja_: 4glj A:

Lineage for d4glja_ (4glj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [193248] (2 PDB entries)

8. Domain d4glja_: 4glj A: [193249]
   automated match to d1v4nb_
   complexed with cl, po4, rhb

Details for d4glja_

PDB Entry: 4glj, 1.9 Å

PDB Description: crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b

PDB Compounds: (A:) RsfP

SCOPe Domain Sequences for d4glja_:

Sequence; same for both SEQRES and ATOM records:

>d4glja_ c.56.2.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
knaadiaiiggsglyqmqaltnkrsvkietpygepsddivlgelngvtvafltrhgqghr
ltpsevpyraniyalktlgvryivsvsavgslqetlkpldmvipdqmidmtkqrvstffg
dgavahvsmadplcpevadiliraydnadiadgqchakatyvciegpqfstraeshwyrq
mqadiigmtnmpeaklareasiayatlalvtdfdcwhpneqavsadyaiqnlmknadnaq
qvikqavaliaseqpksiahtaltqalvtpveamsaetktrlaallp

Timeline for d4glja_:

• d4glja_ first appeared in SCOPe 2.02
  
• d4glja_ appears in SCOPe 2.04
  
• d4glja_ appears in SCOPe 2.06
  
• d4glja_ appears in the current release, SCOPe 2.08