Lineage for d4prga_ (4prg A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6372Protein Peroxisome proliferator activated receptor gamma, PPAR-RXR [48524] (1 species)
  7. 6373Species Human (Homo sapiens) [TaxId:9606] [48525] (6 PDB entries)
  8. 6382Domain d4prga_: 4prg A: [19319]

Details for d4prga_

PDB Entry: 4prg (more details), 2.9 Å

PDB Description: 0072 partial agonist ppar gamma cocrystal

SCOP Domain Sequences for d4prga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-RXR {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOP Domain Coordinates for d4prga_:

Click to download the PDB-style file with coordinates for d4prga_.
(The format of our PDB-style files is described here.)

Timeline for d4prga_: