SCOPe 2.08: Domain d4fqtb_: 4fqt B:

Lineage for d4fqtb_ (4fqt B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (10 species)
   not a true protein

7. Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries)

8. Domain d4fqtb_: 4fqt B: [193181]
   automated match to d3k1ea_
   complexed with 0vt, pg4

Details for d4fqtb_

PDB Entry: 4fqt, 2.2 Å

PDB Description: Structure of AgamOBP1 Bound to 6-methyl-5-hepten-2-one

PDB Compounds: (B:) Anopheles Gambiae Odorant Binding protein 1

SCOPe Domain Sequences for d4fqtb_:

Sequence; same for both SEQRES and ATOM records:

>d4fqtb_ a.39.2.0 (B:) automated matches {Anopheles gambiae [TaxId: 180454]}
dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
hyflv

Timeline for d4fqtb_:

• d4fqtb_ first appeared in SCOPe 2.02
  
• d4fqtb_ appears in SCOPe 2.07