Lineage for d3prga_ (3prg A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156240Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 156241Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 156242Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (17 proteins)
  6. 156295Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 156296Species Human (Homo sapiens) [TaxId:9606] [48525] (8 PDB entries)
  8. 156305Domain d3prga_: 3prg A: [19318]

Details for d3prga_

PDB Entry: 3prg (more details), 2.9 Å

PDB Description: ligand binding domain of human peroxisome proliferator activated receptor

SCOP Domain Sequences for d3prga_:

Sequence, based on SEQRES records: (download)

>d3prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
avhylnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
tdlrqivtehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d3prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
avhylnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
dkiskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml
aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav
iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv
qllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d3prga_:

Click to download the PDB-style file with coordinates for d3prga_.
(The format of our PDB-style files is described here.)

Timeline for d3prga_: